PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_10658_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28103.1 Da    PI: 7.825
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_10658_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.13.2e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +rienk nrqvtfskRrng+lKKA+ELS LCdaevaviifss+gkl+e++s
  Neem_10658_f_1  9 ERIENKVNRQVTFSKRRNGLLKKAYELSLLCDAEVAVIIFSSHGKLFEFAS 59
                    69***********************************************86 PP

2K-box45.63.1e-161241803288
           K-box  32 qreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelq 88 
                     + ++ h+lGedL++L +keLq++e+qL++ l   R++K++++++q+e+lq+k  e +
  Neem_10658_f_1 124 EINLLHFLGEDLGTLGVKELQKIEKQLDRTLALARQRKTDIMVQQLEKLQQKLIEEE 180
                     56788***********************************************87755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.847161IPR002100Transcription factor, MADS-box
CDDcd002656.21E-43276No hitNo description
SuperFamilySSF554556.8E-33283IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.6E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-303859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.76186193IPR002487Transcription factor, K-box
PfamPF014864.9E-12120175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGKVVLER IENKVNRQVT FSKRRNGLLK KAYELSLLCD AEVAVIIFSS HGKLFEFASN  60
DVAKILERYR QCCYTSPASY INEQDTEALF PEILRLRATC ESLQRTQRLN FNLSFCELNN  120
HNNEINLLHF LGEDLGTLGV KELQKIEKQL DRTLALARQR KTDIMVQQLE KLQQKLIEEE  180
GQCVEAVREP GTGRSNIDHV RMMNPSPSAP NLQIGYHQFS LEDRASIEAG VSLAAGRFNP  240
NPAQGWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A1e-22289187Myocyte-specific enhancer factor 2A
3kov_B1e-22289187Myocyte-specific enhancer factor 2A
3kov_I1e-22289187Myocyte-specific enhancer factor 2A
3kov_J1e-22289187Myocyte-specific enhancer factor 2A
3p57_A1e-22289187Myocyte-specific enhancer factor 2A
3p57_B1e-22289187Myocyte-specific enhancer factor 2A
3p57_C1e-22289187Myocyte-specific enhancer factor 2A
3p57_D1e-22289187Myocyte-specific enhancer factor 2A
3p57_I1e-22289187Myocyte-specific enhancer factor 2A
3p57_J1e-22289187Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006490461.12e-80PREDICTED: MADS-box transcription factor 6
TrEMBLU5FXL43e-73U5FXL4_POPTR; Uncharacterized protein
STRINGVIT_15s0048g01270.t013e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2956522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.19e-50AGAMOUS-like 6